Submission form

Your data set should include at least one distinct DNA sequence, and sequence should be in FASTA format. A sequence in FASTA format consists of a single-line description, followed by lines of sequence data. The first character of the description line is a greater-than (">") symbol in the first column.

Example of FASTA format:


     >my_sequence
     ATGTTTGAAATTAATCCGGTAAATAATCGCATTCAGGACCTCACGGAACG
     CTCCGACGTTCTTAGGGGGTATCTTTGACTACGACGCCAAGAAAGAGCGT
     CTGGAAGAAGTAAACGCCGAGCTGGAACAGCCGGATGTCTGGAACGAACC
     CGAACGCGCACAGGCGCTGGGTAAAGAGCGTTCCTCCCTCGAAGCCGTTG
     TCGACACCCTCGACCAAATGAAACAGGGGCTGGAAGATGTTTCTGGTCTG
     CTGGAACTGGCTGTAGAAGCTGACGACGAAGAAACCTTTAACGAAGCCGT
     TGCTGAACTCGACGCCCTGGAAGAAAAACTGGCGCAGCTTGAGTTCCGCC
     GTATGTTCTCTGGCGAATATGACAGCGCCGACTGCTACCTCGATATTCAG
     GCGGGGTCTGGCGGTACGGAAGCACAGGACTGGGCGAGCATGCTTGAGCG
     TATGTATCTGCGCTGGGCAGAATCGCGTGGTTTCAAAACTGAAATCATCG
     AAGAGTCGGAAGGTGAAGTGGCGGGTATTAAATCCGTGACGATCAAAATC
     TCCGGCGATTACGCTTACGGCTGGCTGCGTACAGAAACCGGCGTTCACCG
     CCTGGTGCGTAAAAGCCCGTTTGACTCCGGCGGTCGTCGCCACACGTCGT
     TCAGCTCCGCGTTTGTTTATCCGGAAGTTGATGATGATATTGATATCGAA
     ATCAACCCGGCGGATCTGCGCATTGACGTTTATCGCACGTCCGGCGCGGG
     CGGTCAGCACGTTAACCGTACCGAATCTGCGGTGCGTATTACCCACATCC
     CGACCGGGATCGTGACCCAGTGCCAGAACGACCGTTCCCAGCACAAGAAC
     AAAGATCAGGCCATGAAGCAGATGAAAGCGAAGCTTTATGAACTGGAGAT
     GCAGAAGAAAAATGCCGAGAAACAGGCGATGGAAGATAACAAATCCGACA
     TCGGCTGGGGCAGCCAGATTCGTTCTTATGTCCTTGATGACTCCCGCATT
     AAAGATCTGCGCACCGGGGTAGAAACCCGCAACACGCAGGCCGTGCTGGA
     CGGCAGCCTGGATCAATTTATCGAAGCAAGTTTGAAAGCAGGGTTATGA
          

Lower-case and upper-case letters are both accepted. The full standard IUPAC nucleic acid code is not supported: only A, C, G, T and U symbols are recognized. Numerical digits 0, ..., 9, - and dot . symbols are not accepted.

Output

For each sequence, Automated Release Factor Annotation returns a putative release factor. For each sequence, the result is formatted as GenBank entry fragment or an XML record with a Document Type Definition (DTD).

If no release factor is detected, then the message No Hit is displayed.


     gene            1..1099
                     /locus_tag="my_sequence"
                     /gene="prfB"
     CDS             join(1..75,77..1099)
                     /gene="prfB"
                     /locus_tag="my_sequence"
                     /note="RF2 ORF0: 1.6e-09 ORF1: 2.2e-278"
                     /codon_start=1
                     /transl_table=11
                     /product="Bacterial release factor 2"
                     /translation="MFEINPVNNRIQDLTERSDVLRGYLDYDAKKERLEEVNAELEQP
                     DVWNEPERAQALGKERSSLEAVVDTLDQMKQGLEDVSGLLELAVEADDEETFNEAVAE
                     LDALEEKLAQLEFRRMFSGEYDSADCYLDIQAGSGGTEAQDWASMLERMYLRWAESRG
                     FKTEIIEESEGEVAGIKSVTIKISGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFS
                     SAFVYPEVDDDIDIEINPADLRIDVYRTSGAGGQHVNRTESAVRITHIPTGIVTQCQN
                     DRSQHKNKDQAMKQMKAKLYELEMQKKNAEKQAMEDNKSDIGWGSQIRSYVLDDSRIK
                     DLRTGVETRNTQAVLDGSLDQFIEASLKAGL"
          
xhtml - css